PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 987aa    MW: 109360 Da    PI: 6.5262
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09331.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.6e-28576625352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  KHN09331.1 576 ISISLNVLQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 625
                 589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.642562645IPR003035RWP-RK domain
PfamPF020426.4E-25578625IPR003035RWP-RK domain
SuperFamilySSF542779.48E-22886972No hitNo description
SMARTSM006662.4E-24887969IPR000270PB1 domain
PROSITE profilePS5174523.628887969IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-25887968No hitNo description
CDDcd064075.92E-35888968No hitNo description
PfamPF005641.1E-17888968IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 987 aa     Download sequence    Send to blast
MSESKEENPD LLLKSKAQEE HGFVMDFGIG LEILWPLDHI SLVSNPMPPF LFSTISEQPF  60
SPVWAFSDAE DERQIRIAAS GNTNTTTENP IENDDNKKTV PPLVAMTASE NPDGYCLIKE  120
RMTQALRHFK ELTEQNVLAQ VWAPVRNGNR YALTTSGQPF VLDPHSNGLH QYRTASLMYM  180
FSVDGENDEI LGLPGRVFQH KIPEWTPNVQ FYSSKEYQRL NHAQHYNVRG TLALPVFELA  240
GQSCVAVVEL IMTSQKINYA PEVDKICKAL ETVKLRSSEI LEHPYNQICN EYRQYALAEI  300
LEILTAVCET HSLPLAQTWV PCKHRSVLAH GGGLKKICSS FNGCCMGQVC MSITEVAFYV  360
IDAHKWGFHE ACVEHHLQQG QGVAGRAFLS HNMCFCGNNT QFCKTEYPLV HYALMFHLNS  420
CFAVCLQSSH TGNDDYVLEF FLPPGITDFN EQKRLLGSIL ATMKPHFQSL KIASGVELEG  480
NASIEIIDAR NERVHLRFES IPITQSSKSP PRHTSPNMGE GLPLEPSEPK IMAYFDGIND  540
GGSLGDNAGG HIDQNTSLEI KTKKKPSDRK RGKAEISISL NVLQHYFTGS LKDAAKSLGV  600
CPTTMKRICR QHGISRWPSR KIKKVNHSLS KLKCVIESVH GAEGAFGLNS LSTGSLPIAA  660
GSFSDPFTSN KFHRQTTLTI RPSEPKINEN DFDASGASET KRQVAMEDQF LGLEARTRSP  720
EKVINDKGVS IQEIGTKGTN KFRTGSGSSG SGNPTHASCH GSPPNEFSPP KDTFVTGNSE  780
QCLVLRGSLG STTLHSTSTP NRATAYPMLH IVETTEPQEP FGGQLLEVAG SSKDLRNLCP  840
SADAVLEDQV PEAYKMNPQC SDLPQMQHMD TLNKTMTPFA VRKEVNSVTI KATYKEDIIR  900
FKISMDCGIV ELKEEIAKRL KLEVGTFHNK YLDDDHEWVL IACDADLQEC IDISRSSGGN  960
IIRLVVHDIL PILGSSCESS RDWKGCI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548181.10.0PREDICTED: protein NLP7-like isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A0B2PIY70.0A0A0B2PIY7_GLYSO; Protein NLP7
STRINGGLYMA16G30180.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]